PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00078.162
Common NameAMTR_s00078p00171140, LOC18432033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 216aa    MW: 23946.1 Da    PI: 9.2064
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00078.162genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.2e-32139197159
                                               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  evm_27.model.AmTr_v1.0_scaffold00078.162 139 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 197
                                               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-33124197IPR003657WRKY domain
SuperFamilySSF1182901.1E-28131198IPR003657WRKY domain
PROSITE profilePS5081129.356134199IPR003657WRKY domain
SMARTSM007749.8E-37139198IPR003657WRKY domain
PfamPF031063.1E-25140196IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MNQGMFQGDE GLVTSSMGFQ GHEPTSWGLS GNGYHGLFRA MNGLSAMAPP LMLDANGEGE  60
SGCNLFTVAQ SNGAIGPAPL QKMKTSLWSL GEEEGLGCRR AASEDHLGAS AIKMKKVKVR  120
RKVREPRFCF KTMSDIDVLD DGYKWRKYGQ KVVKNTQHPR SYYRCTQDNC RVKKRVERLA  180
EDPRMVITTY EGRHVHSPSH DTENSPTSSH INFFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-26130196874Probable WRKY transcription factor 4
2lex_A1e-26130196874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123KVRRKVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006842206.11e-164PREDICTED: protein WRKY1
TrEMBLW1P8E81e-164W1P8E8_AMBTC; Uncharacterized protein
STRINGVIT_07s0031g01840.t012e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.12e-52WRKY DNA-binding protein 13
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]